| Transcript | Ll_transcript_476094 |
|---|---|
| CDS coordinates | 257-646 (+) |
| Peptide sequence | MRVGFSHRFFDFPRRITAICSAPDHLYQGNFLTPKNFHTSVIDLHRQSLKSEIIFQLNGIRLNDVRRVTYIFPQLRHVEYIMQVGQQRRQSYPIGYRSNLPNDLIRANELGSKLSSFQNPANTSRWNHS* |
| ORF Type | complete |
| Blastp | Transposon Tf2-8 polyprotein from Schizosaccharomyces with 32.1% of identity |
|---|---|
| Blastx | Transposon Tf2-8 polyprotein from Schizosaccharomyces with 32.71% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPAC13D1.01c) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_012575125.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer