Protein coding transcript 40469

• Transcript: Ll_transcript_475043
• CDS coordinates: 1-648 (+)
• Peptide sequence: QQWIIIYRVTCLHSLNLSGNDNEIEIYMALSLTISVPFPQLQQRFPILFKPKPKPTLSFITSSYSLPDFKVGQDLPPNYADWLPKPDPKHRRRAGILLHPTSFRGPYGIGDFGDEAFRFIDWLHYSGCSLWQVLPLVPPDGAGSPYSSQDANCGNTLLISLEHLVEDGLLEKHELPEPIEAEQVNFSVVADLKNPLITKAAKRLISSEGELKKTA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_475043

• Blastp: 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic from Arabidopsis with 65.29% of identity
• Blastx: 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic from Oryza sativa with 52.51% of identity
• Eggnog: 4-alpha-glucanotransferase(COG1640)
• Kegg: Link to kegg annotations (AT5G64860)
• CantataDB: Link to cantataDB annotations (CNT0002507)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430233.1)
• Pfam: 4-alpha-glucanotransferase (PF02446.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;