Transcript | Ll_transcript_475068 |
---|---|
CDS coordinates | 1-567 (+) |
Peptide sequence | QQWIIIYRVTCLHSLNLSGNDNEIEIYMALSLTISVPFPQLQQRFPILFKPKPKPTLSFITSSYSLPDFKVGQDLPPNYADWLPKPDPKHRRRAGILLHPTSFRGPYGIGDFGDEAFRFIDWLHYSGCSLWQVLPLVPPDGAGSPYSSQDANCGNTLLISLEHLVEDGLLEKHELPEPMSDSLHVSLT* |
ORF Type | 5prime_partial |
Blastp | 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic from Arabidopsis with 64.34% of identity |
---|---|
Blastx | 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic from Arabidopsis with 64.34% of identity |
Eggnog | 4-alpha-glucanotransferase(COG1640) |
Kegg | Link to kegg annotations (AT5G64860) |
CantataDB | Link to cantataDB annotations (CNT0002507) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430233.1) |
Pfam | 4-alpha-glucanotransferase (PF02446.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer