Transcript | Ll_transcript_475073 |
---|---|
CDS coordinates | 4151-4561 (+) |
Peptide sequence | MAVLQFGFGGDADNPHLPHNQECNQVVYTGTHDNDTIKGWWEALKPEEKSNVLSYLSLTEEGDISWALIKTALASVAQTAIIPMQDVLGLGSSARMNTPATQFGNWGWRIASSVSFDSLEKEAERLKEMLSMYGRL* |
ORF Type | complete |
Blastp | 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic from Arabidopsis with 72.06% of identity |
---|---|
Blastx | 4-alpha-glucanotransferase, chloroplastic/amyloplastic from Solanum with 66.14% of identity |
Eggnog | 4-alpha-glucanotransferase(COG1640) |
Kegg | Link to kegg annotations (AT5G64860) |
CantataDB | Link to cantataDB annotations (CNT0002507) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430233.1) |
Pfam | 4-alpha-glucanotransferase (PF02446.16) |
Rfam | tRNA (RF00005) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer