Protein coding transcript 40472

• Transcript: Ll_transcript_475073
• CDS coordinates: 4151-4561 (+)
• Peptide sequence: MAVLQFGFGGDADNPHLPHNQECNQVVYTGTHDNDTIKGWWEALKPEEKSNVLSYLSLTEEGDISWALIKTALASVAQTAIIPMQDVLGLGSSARMNTPATQFGNWGWRIASSVSFDSLEKEAERLKEMLSMYGRL*
• ORF Type: complete

Annotations of Ll_transcript_475073

• Blastp: 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic from Arabidopsis with 72.06% of identity
• Blastx: 4-alpha-glucanotransferase, chloroplastic/amyloplastic from Solanum with 66.14% of identity
• Eggnog: 4-alpha-glucanotransferase(COG1640)
• Kegg: Link to kegg annotations (AT5G64860)
• CantataDB: Link to cantataDB annotations (CNT0002507)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430233.1)
• Pfam: 4-alpha-glucanotransferase (PF02446.16)
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;