Protein coding transcript 40475

• Transcript: Ll_transcript_475046
• CDS coordinates: 1-882 (+)
• Peptide sequence: QQWIIIYRVTCLHSLNLSGNDNEIEIYMALSLTISVPFPQLQQRFPILFKPKPKPTLSFITSSYSLPDFKVGQDLPPNYADWLPKPDPKHRRRAGILLHPTSFRGPYGIGDFGDEAFRFIDWLHYSGCSLWQVLPLVPPDGAGSPYSSQDANCGNTLLISLEHLVEDGLLEKHELPEPIEAEQVNFSVVADLKNPLITKAAKRLISSEGELKKQLETFRRDPTISSWLEDAAYFAAIDDSLNGINWYDWPEPLRNRHLVALEDICQQKRDFVRTERILPAITTSNTSSLFACL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_475046

• Blastp: 4-alpha-glucanotransferase, chloroplastic/amyloplastic from Solanum with 65.16% of identity
• Blastx: 4-alpha-glucanotransferase, chloroplastic/amyloplastic from Solanum with 61.26% of identity
• Eggnog: 4-alpha-glucanotransferase(COG1640)
• Kegg: Link to kegg annotations (102595076)
• CantataDB: Link to cantataDB annotations (CNT0002507)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430233.1)
• Pfam: 4-alpha-glucanotransferase (PF02446.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;