Protein coding transcript 40480

• Transcript: Ll_transcript_475065
• CDS coordinates: 3363-3695 (+)
• Peptide sequence: MAVLQFGFGGDADNPHLPHNQECNQVVYTGTHDNDTVSISFTLRLWFALLVYYISWLFYFLISLLQIKGWWEALKPEEKSNVGAIFSSQVFFFNKFDYSSSCSLFICFRC*
• ORF Type: complete

Annotations of Ll_transcript_475065

• Blastp: 4-alpha-glucanotransferase, chloroplastic/amyloplastic from Solanum with 51.22% of identity
• Blastx: 4-alpha-glucanotransferase, chloroplastic/amyloplastic from Solanum with 66.14% of identity
• Eggnog: 4-alpha-glucanotransferase(COG1640)
• Kegg: Link to kegg annotations (102595076)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430233.1)
• Pfam: 4-alpha-glucanotransferase (PF02446.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;