Protein coding transcript 40502

• Transcript: Ll_transcript_476204
• CDS coordinates: 550-915 (+)
• Peptide sequence: MAGILSLVTGKAGPSGFGSASTAEHVTDGIDASNLTAIITGGASGIGLETARVLCLRKAHVIIAVRNMDSAKEAKKLILQENESAKVDIMKLDLCSLKSVRSFVDKFIALDLPLNILMWFP*
• ORF Type: complete

Annotations of Ll_transcript_476204

• Blastp: Short-chain dehydrogenase TIC 32, chloroplastic from Arabidopsis with 54.13% of identity
• Blastx: Short-chain dehydrogenase TIC 32, chloroplastic from Pisum with 66.67% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT4G23430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426534.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;