Protein coding transcript 40563

• Transcript: Ll_transcript_477324
• CDS coordinates: 197-985 (+)
• Peptide sequence: MEHHLTLQEAASSRLKSMEHLVHLLSSQTQTHSFTHNNNNNNVNLNLINLLNRTGHARFRRAPSRLEHKPELETQQLGLNLDFSKTDFVKAKSNNKEDTLSISTTTSSFMSTITVTGDGSVSDGKIGPFLSPPAPAVSASKPPLSSSHRKRCHDVSISGTCHCSKRRKSRVKRRIHVAAISSKMADEYSWRKYGQKPIKGSPYPRGYYKCSMVRGCSARKHVERAQHDPKMLIVTYEGEHLHAQPCPPGTTATGVNFSLKSS*
• ORF Type: complete

Annotations of Ll_transcript_477324

• Blastp: Probable WRKY transcription factor 11 from Arabidopsis with 45% of identity
• Blastx: Probable WRKY transcription factor 11 from Arabidopsis with 44.07% of identity
• Eggnog: WRKY transcription factor(ENOG410YD1E)
• Kegg: Link to kegg annotations (AT4G31550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414456.1)
• Pfam: Plant zinc cluster domain (PF10533.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;