Transcript | Ll_transcript_469152 |
---|---|
CDS coordinates | 1-474 (+) |
Peptide sequence | SNGELLARAVWARLRYHPEVVLDGLRGALVRKTGTQQGVQMPEVTQYHPEMFVDDKWFAKVREEMYIVPDGERVVIQVIRNETQKDTDESKLWYWLEDTHMNVFHWRWHINYPPCCDDDVYVDRDRRGELFVYFHRQMLSRLNAERFANGAPRLLALD |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Phenoloxidase 2 from Sophophora with 41.03% of identity |
Eggnog | prophenoloxidase(ENOG4111KTW) |
Kegg | Link to kegg annotations (Dmel_CG8193) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_006593077.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer