Protein coding transcript 408

• Transcript: Ll_transcript_316843
• CDS coordinates: 2-349 (+)
• Peptide sequence: PSSVKTPPKTPIKSERKPVWYYAMMSETSEVKELISKSCNVNEPDPSGYTALHYAAKNGNVEICRLLLNSGAAVNLQTQAGQATPLHRAAGAGKIEVCKLLLNCGAQVLLRDIDGR
• ORF Type: internal

Annotations of Ll_transcript_316843

• Blastp: Ankyrin repeat domain-containing protein 39 from Bos with 43.43% of identity
• Blastx: Ankyrin repeat domain-containing protein 39 from Bos with 43.43% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (510840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014492886.1)
• Pfam: Ankyrin repeats (many copies) (PF13637.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;