Transcript | Ll_transcript_474956 |
---|---|
CDS coordinates | 115-588 (+) |
Peptide sequence | MKNIFSKKPTPKEALRESKREMNNAARGIEREIGALQLEEKKLVLEIKKTAKTGNEAATKILARQLVRLRQQIANLQGSRAQMRGITTHTQAMYAQSSVAVGMKGATKAMAAMNKVACFSYISFLLIIYCYIFLFKLNRDCKILFSFYPQKEKKGMI* |
ORF Type | complete |
Blastp | Vacuolar protein sorting-associated protein 2 homolog 3 from Arabidopsis with 81.42% of identity |
---|---|
Blastx | Vacuolar protein sorting-associated protein 2 homolog 3 from Arabidopsis with 81.44% of identity |
Eggnog | Charged multivesicular body protein(COG5491) |
Kegg | Link to kegg annotations (AT1G03950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426723.1) |
Pfam | Snf7 (PF03357.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer