Protein coding transcript 40850

• Transcript: Ll_transcript_476637
• CDS coordinates: 2127-2555 (+)
• Peptide sequence: MIQDYEYASYNPLAYDLANHFCEMVADYHSDTPHILDYTKYPELEERQRFIRIYLTSEGKKPSNARVEQLVNAAEKYTLANHLFWGLWGLISSYVNKIDFDYKEYAKQRFQQYWIRKPTLLNSPSIVSQDDEIVNDSLPSFK*
• ORF Type: complete

Annotations of Ll_transcript_476637

• Blastp: Probable choline kinase 3 from Arabidopsis with 71.07% of identity
• Blastx: Probable choline kinase 2 from Arabidopsis with 65% of identity
• Eggnog: Ethanolamine kinase(COG0510)
• Kegg: Link to kegg annotations (AT4G09760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427266.1)
• Pfam: Choline/ethanolamine kinase (PF01633.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;