Protein coding transcript 40852

• Transcript: Ll_transcript_476644
• CDS coordinates: 1826-2143 (+)
• Peptide sequence: MLSQCCFTRNWLSESKTICFPKDIKNFGLENLDEEINMLEKLLSEGYEDIGFCHNDLQYGNIMMDEETRSITLIVSGFSIVWIVVIYSLPCGCIFLICMANDTGL*
• ORF Type: complete

Annotations of Ll_transcript_476644

• Blastp: Probable choline kinase 2 from Arabidopsis with 60.61% of identity
• Blastx: Probable choline kinase 2 from Arabidopsis with 63.74% of identity
• Eggnog: Ethanolamine kinase(COG0510)
• Kegg: Link to kegg annotations (AT1G74320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017412339.1)
• Pfam: Choline/ethanolamine kinase (PF01633.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;