Protein coding transcript 40866

• Transcript: Ll_transcript_476676
• CDS coordinates: 2050-2610 (+)
• Peptide sequence: MNTIPNICNRDLLSTDSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGHYSAINWFFLGGAIAPFLVWLAHKAFPEKQWIKLISLPVILGALSDMPPATSVNYFSWVLVGFASGFITYRYYRGWWIRHNYVLSGALDAGLAFMGVLLYLCLGMEHISLNWWGSNSDGCPLASCPTAPGVQAKGCPLY*
• ORF Type: complete

Annotations of Ll_transcript_476676

• Blastp: Oligopeptide transporter 7 from Arabidopsis with 69.89% of identity
• Blastx: Oligopeptide transporter 7 from Arabidopsis with 69.54% of identity
• Eggnog: oligo-peptide transporter(ENOG410XNZC)
• Kegg: Link to kegg annotations (AT4G10770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424367.1)
• Pfam: OPT oligopeptide transporter protein (PF03169.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;