Protein coding transcript 409

• Transcript: Ll_transcript_316832
• CDS coordinates: 36-374 (+)
• Peptide sequence: MVAQKAKWMVEAQKRVDAKKAAKKASGEVAPKKKFKKMRHGRLYARAIFTGYKRGLRNQHENTALLKVEGCSAKQDSEFYVGKKVVYVYRSRNKTSVPGKTKLKTKVRAIWGK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_316832

• Blastp: 60S ribosomal protein L35a from Bos with 58.9% of identity
• Blastx: 60S ribosomal protein L35a from Bos with 58.9% of identity
• Eggnog: Ribosomal protein(COG2451)
• Kegg: Link to kegg annotations (506768)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447949.1)
• Pfam: Ribosomal protein L35Ae (PF01247.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;