Protein coding transcript 40970

• Transcript: Ll_transcript_475900
• CDS coordinates: 192-521 (+)
• Peptide sequence: MEEYGGQEGLYHKISALLEFSAADDLISFKDAVEKEGHDVDGVGLWYGRRIGSNKVGYEERTPLMIASMFGSLSVLTYILGTGRVDVKRASRSDGDTALHCAVAGGPAAS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_475900

• Blastp: Zinc finger CCCH domain-containing protein 66 from Arabidopsis with 60.75% of identity
• Blastx: Zinc finger CCCH domain-containing protein 66 from Arabidopsis with 60.75% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410XR0Z)
• Kegg: Link to kegg annotations (AT5G58620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001304583.1)
• Pfam: Ankyrin repeats (many copies) (PF13637.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;