Protein coding transcript 410

• Transcript: Ll_transcript_316836
• CDS coordinates: 2-328 (+)
• Peptide sequence: NIIEGVLPYSLGQLQLLEKMDLHSNKIIGTIPPYLGRLKRLVLLDLSHNLIVGPIPITLSSLELLEYLVIDHNPIKGGIPFFIGNLRKLKSVSLSGCELIGPIPNFFSS
• ORF Type: internal

Annotations of Ll_transcript_316836

• Blastp: Leucine-rich repeat receptor-like protein kinase PEPR2 from Arabidopsis with 40.74% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase FLS2 from Oryza sativa with 37.5% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G17750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446146.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;