Protein coding transcript 41075

• Transcript: Ll_transcript_475376
• CDS coordinates: 310-1056 (+)
• Peptide sequence: MMKLCMLSLFNGCQHNISKLSALVDYSLMQLKCSLKIHEKLKTFQSSAICEDEKSLRKSSKDISKRNASRVSPYVDKDSRMLISQAVSFIELLVRNYMKPIECMPFHEIFCFKDVEKLQSVLIGDPRSRIQVDLLESYKILRCSCCNKSGNAILPSKHDSSIMYSLAQEHGDLINLHDWFQSFRTIIVQPTTKRKQKTKQPSHGSGDQNEASIQARFCRAVTELQITGLVRMPSKRRPDFVQRIAFGL*
• ORF Type: complete

Annotations of Ll_transcript_475376

• Blastp: Origin of replication complex subunit 3 from Arabidopsis with 53.43% of identity
• Blastx: Origin of replication complex subunit 3 from Arabidopsis with 55.5% of identity
• Eggnog: origin recognition complex subunit(ENOG410XT1W)
• Kegg: Link to kegg annotations (AT5G16690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413103.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;