Protein coding transcript 41076

• Transcript: Ll_transcript_475377
• CDS coordinates: 3-395 (+)
• Peptide sequence: EIPQWITLETFCHHKLLSLCVSKFLLGTPAEKMDAIVEAVLVKQCTTFNIGHKVALFLQNFFINQDGTLTSFIRALKVACLLHFSMEPLSVIHGRLAEDQMGKSALSPETMLKYMDELPTDGRNQMVDQT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_475377

• Blastp: Origin of replication complex subunit 3 from Arabidopsis with 44.17% of identity
• Blastx: Origin of replication complex subunit 3 from Arabidopsis with 38.49% of identity
• Eggnog: origin recognition complex subunit(ENOG410XT1W)
• Kegg: Link to kegg annotations (AT5G16690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413103.1)
• Pfam: Origin recognition complex (ORC) subunit 3 N-terminus (PF07034.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;