Protein coding transcript 41081

• Transcript: Ll_transcript_477220
• CDS coordinates: 430-1002 (+)
• Peptide sequence: MAQDWNRTALLIIDMQRDFIEDGAPLLVKGGKDIVPNVIKAVEIARHLGLHIVWVVREHDPLGRDVELFRRHLYTTGRVGPTSKGSAGAELVDGLVIREGDYKLVKTRFSAFFATHLHSVLQGAGINSLVITGVQTPNCIRQTAFDAVALDYQSVTVIADATAAATPDIHLGMYFSNFLKALQIAGTLFS*
• ORF Type: complete

Annotations of Ll_transcript_477220

• Blastp: Probable inactive nicotinamidase At3g16190 from Arabidopsis with 70.76% of identity
• Blastx: Probable inactive nicotinamidase At3g16190 from Arabidopsis with 69.93% of identity
• Eggnog: isochorismatase(COG1335)
• Kegg: Link to kegg annotations (AT3G16190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424973.1)
• Pfam: Isochorismatase family (PF00857.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;