Protein coding transcript 4112

• Transcript: Ll_transcript_428751
• CDS coordinates: 1-396 (+)
• Peptide sequence: LILLCVRCSHQLHFTLHCELFRWTSMGPLTLSVTVQDSSISSPDACTTRKQNSLVRNSFASVSIGEENPFDFLRSLFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGEKLVFKGLYSGLAGNLVGVLP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_428751

• Blastp: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial from Arabidopsis with 67.89% of identity
• Blastx: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial from Arabidopsis with 67.89% of identity
• Eggnog: mitochondrial carrier protein(ENOG4110BII)
• Kegg: Link to kegg annotations (AT4G39460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462507.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;