Protein coding transcript 41177

• Transcript: Ll_transcript_525871
• CDS coordinates: 323-1102 (+)
• Peptide sequence: MTERGGKRERMKNIFKKLHIGSNNNNNDPHRSNETAPPVPSPLSTADNRTVRNATASPVTASPSSSPSTAAAVPSAAATTPAMNRQDFISSEEEFQMQLALAISASNSEFRDDPEKDQIHTATLLSLGGRQIDSAMNKDDAAEALSRHYWEYNVLDYEEKVIDGFYDVYGLNTDSSMQGKMPSLADLEADPGSSIFEVVIVNQTIDPALEELMQIAHCIALDCPVTEVGILVQRLAELVTSHMGGPVKDANIISARWTER
• ORF Type: 3prime_partial

Annotations of Ll_transcript_525871

• Blastp: Serine/threonine-protein kinase EDR1 from Arabidopsis with 55.25% of identity
• Blastx: Serine/threonine-protein kinase EDR1 from Arabidopsis with 52.94% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G08720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427436.1)
• Pfam: Ethylene-responsive protein kinase Le-CTR1 (PF14381.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;