Protein coding transcript 41178

• Transcript: Ll_transcript_525873
• CDS coordinates: 323-799 (+)
• Peptide sequence: MTERGGKRERMKNIFKKLHIGSNNNNNDPHRSNETAPPVPSPLSTADNRTVRNATASPVTASPSSSPSTAAAVPSAAATTPAMNRQDFISSEEEFQMQLALAISASNSEFRDDPEKDQIHTATLLSLGGRQIDSAMNKDDAAEALSRHYWVRSLIFSE*
• ORF Type: complete

Annotations of Ll_transcript_525873

• Blastp: Serine/threonine-protein kinase EDR1 from Arabidopsis with 48.98% of identity
• Blastx: Serine/threonine-protein kinase EDR1 from Arabidopsis with 44.83% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G08720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427436.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;