Protein coding transcript 41230

• Transcript: Ll_transcript_527389
• CDS coordinates: 553-1008 (+)
• Peptide sequence: MLLYLRCDVISRYLNVIQTSAPHLLRYLATAFVVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVYVNYDFDGAQKKMRECEEVILNDPFLCKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQRIDMRVLAEKLNLNDEVAERWIVN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_527389

• Blastp: Eukaryotic translation initiation factor 3 subunit E from Arabidopsis with 86.52% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit E from Arabidopsis with 86.52% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XQK5)
• Kegg: Link to kegg annotations (AT3G57290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417247.1)
• Pfam: PCI domain (PF01399.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;