| Transcript | Ll_transcript_525991 |
|---|---|
| CDS coordinates | 39-398 (+) |
| Peptide sequence | MAMQLKPFTLRLGQSQPRNLNFPNKHQIVTRCSLRDSVSNTHNHKLVHQFNPKIPIEEAVTPPTSWYTDPSFFHLELHRIFYTGWQVVGQFILLQVSTFLFFLFLGFFFIFLFPILVEC* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Choline monooxygenase, chloroplastic from Arabidopsis with 66.67% of identity |
| Eggnog | rieske 2fe-2S domain-containing protein(COG4638) |
| Kegg | Link to kegg annotations (AT4G29890) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463425.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer