| Transcript | Ll_transcript_432001 |
|---|---|
| CDS coordinates | 3-308 (+) |
| Peptide sequence | LTHTICICDHLTNFAILMDIQATYLPPSHQLALQIITYVGCIISIICLILSIITFQLFRGLKSDRTTIHKNLCVCLLIAEVLFVAGIGQTDQAILCGVIAGL |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Adhesion G protein-coupled receptor L3 from Homo with 53.92% of identity |
| Eggnog | G- protein-coupled receptor(ENOG410XSD2) |
| Kegg | Link to kegg annotations (23284) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_016171155.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer