Transcript | Ll_transcript_428756 |
---|---|
CDS coordinates | 2-565 (+) |
Peptide sequence | QLKRHMATTTKPRPNITFFFLLLVLPFNFGKSQLQLNYYTNSCSKAEEIIKQQVFQLYNKHGNTAISWVRNLFHDCMVKSCDASLLLVNRGGVVSEQTAERSFGMRNFKYVNTIKEAVEQECPLTVSCADIVALSARDGIAMVCHIYVCCGGVNVVILGHLTCYSHGSINLLSMSSISNLNISFYST* |
ORF Type | 5prime_partial |
Blastp | Peroxidase 21 from Arabidopsis with 71.79% of identity |
---|---|
Blastx | Peroxidase 21 from Arabidopsis with 72.81% of identity |
Eggnog | peroxidase(ENOG410YHIH) |
Kegg | Link to kegg annotations (AT2G37130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432275.1) |
Pfam | Peroxidase (PF00141.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer