Protein coding transcript 41512

• Transcript: Ll_transcript_525466
• CDS coordinates: 334-858 (+)
• Peptide sequence: MESGLPLLNCLLQQTLRSICSSQNSSTSSKWGYAIFWRILPRNFPPPRWEFGGTALDRSKGNKRNWILVWEDGFCDFNECEQRKSGCLNNGFGADLFFKMSHEVYNYGEGIVGKVASDNGHKWVYSDDTHNECEPSYIASWNASIEPQPKAWEFQFKSGIQVAKFIHKHVIEIE*
• ORF Type: complete

Annotations of Ll_transcript_525466

• Blastp: Protein RICE SALT SENSITIVE 3 from Oryza sativa with 40.25% of identity
• Blastx: Protein RICE SALT SENSITIVE 3 from Oryza sativa with 42.14% of identity
• Eggnog: NA(ENOG410YAU9)
• Kegg: Link to kegg annotations (4350435)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437929.1)
• Pfam: bHLH-MYC and R2R3-MYB transcription factors N-terminal (PF14215.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;