Transcript | Ll_transcript_525471 |
---|---|
CDS coordinates | 637-1668 (+) |
Peptide sequence | MFIFGLYLPKNESLLQRAIEEGADFIETDILSSKDGVLISFHDVTLDEITDVANHQEFANRKRTYEVQGENVTGFFTVDFTLKELKSLRVKQRFNFRDQQYNGKFQIITFEEFISIALEAPRVVGIYPEIKNPVLINQHVKWADGKLFEDKFVETLKKYGYKGSYLSKDWLKQPVFIQSFAPTSLVYTSNLTDLPKILLIDDITVPTQDTNQSYWEITSDSYFEYIKDYVVGIGPWKETVVPVVNNYLQTPSDLVKRAHAHNLLVHPYTYRNENKYLCFNFNQDPYQEYDYWVKKMGVDGLFTDFTGSLHKYQEWTSSNRHNKSDDKSASKLLHKIASLVASY* |
ORF Type | complete |
Blastp | Glycerophosphodiester phosphodiesterase GDPD5 from Arabidopsis with 75.54% of identity |
---|---|
Blastx | Glycerophosphodiester phosphodiesterase GDPD5 from Arabidopsis with 75.54% of identity |
Eggnog | glycerophosphoryl diester phosphodiesterase(COG0584) |
Kegg | Link to kegg annotations (AT1G74210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438899.1) |
Pfam | Glycerophosphoryl diester phosphodiesterase family (PF03009.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer