Transcript | Ll_transcript_526021 |
---|---|
CDS coordinates | 3-1526 (+) |
Peptide sequence | QVYFMAHKPSLPFPFFPLQNLTLKLTLRKHQCRKTQLFNCLGHEIRKWVTCMYNLLFMHVYVLLDIMYVRIFSGYFWDFNTFNMLICKVSQVDSVSCYCKVDSGLKTVAGARKFVPGSKLCIQPDINPNAHKRKNLRRERTRVQTPLIPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYCLLSGNFFYSLRKSLGMAEEWVYVIKRDRDGKISLHAFDPVYQLWQSLPPVPGEYSEALGFGCAVLSGCHLYLFGGRDPLKGSMRRVIFYSARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRWNFVSEMTMPMVPFIGVVHNGMWFLKGLGLNRNVACDAYSPETDTWTPVSNGMVNGWRNPSISLNGQLYALDCRDGCRLKVYDAATDTWTKFIDSKLHLGSSRALDAAALAPLNGKLCIIRNNMSISLVDISSPNKRVESNPQIWENISGKGHASSFVKNLWSTIAGRSGLKSHIVHCQILQI* |
ORF Type | 5prime_partial |
Blastp | F-box/kelch-repeat protein At1g55270 from Arabidopsis with 76.14% of identity |
---|---|
Blastx | F-box/kelch-repeat protein At1g55270 from Arabidopsis with 76.14% of identity |
Eggnog | Kelch repeat-containing F-box family protein(ENOG4110X8D) |
Kegg | Link to kegg annotations (AT1G55270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460750.1) |
Pfam | F-box domain (PF00646.32) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer