Protein coding transcript 41680

• Transcript: Ll_transcript_527207
• CDS coordinates: 499-816 (+)
• Peptide sequence: MSRAYYAHHRTSLFVKVIANLYCFLPDICKEQERNHFILKVLHCLQMDLSNLLPGFSFPSGAPKAATASKNLWSLIIQAESFVPNFLNPEDVQLLRSLVQLLIPL*
• ORF Type: complete

Annotations of Ll_transcript_527207

• Blastp: Nodulin homeobox from Arabidopsis with 45.87% of identity
• Blastx: Nodulin homeobox from Arabidopsis with 46.06% of identity
• Eggnog: HOX(ENOG410XTJ0)
• Kegg: Link to kegg annotations (AT4G03090)
• CantataDB: Link to cantataDB annotations (CNT0002267)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413509.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;