| Transcript | Ll_transcript_527251 |
|---|---|
| CDS coordinates | 499-882 (+) |
| Peptide sequence | MSRAYYAHHRTSLFVKVIANLYCFLPDICKEQERNHFILKVLHCLQMDLSNLLPGFSFPSGAPKAATASKNLWSLIIQAESFVPNFLNPEDVQLLRVFSGELQSLITSTGFEGNRVQVIFYLSELLT* |
| ORF Type | complete |
| Blastp | Nodulin homeobox from Arabidopsis with 48.36% of identity |
|---|---|
| Blastx | Nodulin homeobox from Arabidopsis with 44.02% of identity |
| Eggnog | HOX(ENOG410XTJ0) |
| Kegg | Link to kegg annotations (AT4G03090) |
| CantataDB | Link to cantataDB annotations (CNT0002267) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019413509.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer