Transcript | Ll_transcript_527217 |
---|---|
CDS coordinates | 571-993 (+) |
Peptide sequence | MGLVQLNAMRLAVILSDDSNFKSYLIDCFTDVLTAIISLSHRDFLSCWCSSNLLEIEEDATLEYDTFTAVGWILDNTASLDQQNATILELSLIPKRMSRAYYAHHRTSLFVKVIANLYCFLPDICKGWLFAKALQNFQTN* |
ORF Type | complete |
Blastp | Nodulin homeobox from Arabidopsis with 47.48% of identity |
---|---|
Blastx | Nodulin homeobox from Arabidopsis with 48.1% of identity |
Eggnog | HOX(ENOG410XTJ0) |
Kegg | Link to kegg annotations (AT4G03090) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413509.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer