| Transcript | Ll_transcript_428851 |
|---|---|
| CDS coordinates | 176-586 (+) |
| Peptide sequence | MGSMNWLGFSLAPHEEDNQSQTVAPSLGFNPDATDIPSSFAIFEDLNTNNNQAHTTPQDWNTKGLGSDSSEYNYYNNINQNMLLGTSCNQQQHPKLENFLGQHSFGDNNLNHTTYGGSINHTTSSSGDLMFQNCSLK |
| ORF Type | 3prime_partial |
| Blastp | AP2-like ethylene-responsive transcription factor BBM1 from Brassica with 30.51% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | Link to kegg annotations (106426170) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019439877.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer