Protein coding transcript 41756

• Transcript: Ll_transcript_526439
• CDS coordinates: 130-900 (+)
• Peptide sequence: MGVIHRDLKPENFLLLNKDDDSPLKATDFGLSVFYKQGEVFKDLVGSAYYIAPEVLKRKYGPEVDIWSVGVILYILLCGVPPFWAESETGIFNAILRGHIDFTSDPWPSISPQAKDLVRKMLNMDPKQRLTAYQVLNHPWIKEDGEAPDTPLDNAVLNRLKQFRAMDQFKKVALKVIAGCLSEEEIMGLKQMFKGMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLMEAADADGNGIIDYDEFITATMHMNRMNR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_526439

• Blastp: Calcium-dependent protein kinase 17 from Arabidopsis with 86.77% of identity
• Blastx: Calcium-dependent protein kinase 17 from Arabidopsis with 87% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT5G12180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457090.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;