Protein coding transcript 41831

• Transcript: Ll_transcript_526557
• CDS coordinates: 3-320 (+)
• Peptide sequence: DIPETACVGGKEWYFYTQRDRKYATGLRTNRATASGYWKATGKDRTIHLKGSLIGMRKTLVFYEGRAPKGRKTEWVMHEFRIEGPHGPAISSSSKVSNIMDYYLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_526557

• Blastp: NAC domain-containing protein 21/22 from Arabidopsis with 78.72% of identity
• Blastx: NAC domain-containing protein 21/22 from Arabidopsis with 78.72% of identity
• Eggnog: NAC domain-containing protein 21(ENOG410YDRK)
• Kegg: Link to kegg annotations (AT1G56010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443758.1)
• Pfam: No apical meristem (NAM) protein (PF02365.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;