Protein coding transcript 41873

• Transcript: Ll_transcript_527357
• CDS coordinates: 160-1059 (+)
• Peptide sequence: MNFEFGFWYGLTRPIAIPSEKYKIENISIYEIQNNEPMYNNLNKIEIYLVMVQMIDPYWTVIPVMLVHYYSTHPLSDEYNWWRSKIVILMTWVWSIRLLHNYLRREKWNLGVKEDWRFTILSKQYGTHWCWASFFAIYLPHQVLLIGLSLPFYVIHSMNNPLSILDLVAIILCACGISIAFIADNQLHNFVNINNKLKGLGESMTPILESGLWYYSRHPNYFGEQLWWWGLVVFAWNLGHGWTLIGALANTMCLAYVTKLVEEHMLKQDNRVEAFILYQKTTSIWVPWIKSFHLKNKNA*
• ORF Type: complete

Annotations of Ll_transcript_527357

• Blastp: Uncharacterized protein C594.04c from Schizosaccharomyces with 22.81% of identity
• Blastx: Uncharacterized protein C594.04c from Schizosaccharomyces with 22.81% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPCC594.04c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440477.1)
• Pfam: Protein of unknown function (DUF1295) (PF06966.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;