Transcript | Ll_transcript_527357 |
---|---|
CDS coordinates | 160-1059 (+) |
Peptide sequence | MNFEFGFWYGLTRPIAIPSEKYKIENISIYEIQNNEPMYNNLNKIEIYLVMVQMIDPYWTVIPVMLVHYYSTHPLSDEYNWWRSKIVILMTWVWSIRLLHNYLRREKWNLGVKEDWRFTILSKQYGTHWCWASFFAIYLPHQVLLIGLSLPFYVIHSMNNPLSILDLVAIILCACGISIAFIADNQLHNFVNINNKLKGLGESMTPILESGLWYYSRHPNYFGEQLWWWGLVVFAWNLGHGWTLIGALANTMCLAYVTKLVEEHMLKQDNRVEAFILYQKTTSIWVPWIKSFHLKNKNA* |
ORF Type | complete |
Blastp | Uncharacterized protein C594.04c from Schizosaccharomyces with 22.81% of identity |
---|---|
Blastx | Uncharacterized protein C594.04c from Schizosaccharomyces with 22.81% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPCC594.04c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440477.1) |
Pfam | Protein of unknown function (DUF1295) (PF06966.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer