Protein coding transcript 41878

• Transcript: Ll_transcript_527370
• CDS coordinates: 119-580 (+)
• Peptide sequence: MPTLQLCPTILPIKSEGAPQQPGRRPKVSPQLNRWSRARSIRSGRKLDRSSLRTTTLEPNQPNPPSPLSIPLDPDDAVSDDGADVRFVKSIYIVSDGTGWTAEHCVNAALGQFDYCLVDHGCPVNTHLFSGVTFFPFHYSFAFSNNFFSFEKL*
• ORF Type: complete

Annotations of Ll_transcript_527370

• Blastp: -
• Blastx: Pyruvate, phosphate dikinase regulatory protein 1, chloroplastic from Arabidopsis with 54.47% of identity
• Eggnog: Bifunctional serine threonine kinase and phosphorylase involved in the regulation of the pyruvate, phosphate dikinase (PPDK) by catalyzing its phosphorylation dephosphorylation (By similarity)(COG1806)
• Kegg: Link to kegg annotations (AT4G21210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428072.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;