Transcript | Ll_transcript_527370 |
---|---|
CDS coordinates | 119-580 (+) |
Peptide sequence | MPTLQLCPTILPIKSEGAPQQPGRRPKVSPQLNRWSRARSIRSGRKLDRSSLRTTTLEPNQPNPPSPLSIPLDPDDAVSDDGADVRFVKSIYIVSDGTGWTAEHCVNAALGQFDYCLVDHGCPVNTHLFSGVTFFPFHYSFAFSNNFFSFEKL* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Pyruvate, phosphate dikinase regulatory protein 1, chloroplastic from Arabidopsis with 54.47% of identity |
Eggnog | Bifunctional serine threonine kinase and phosphorylase involved in the regulation of the pyruvate, phosphate dikinase (PPDK) by catalyzing its phosphorylation dephosphorylation (By similarity)(COG1806) |
Kegg | Link to kegg annotations (AT4G21210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428072.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer