Transcript | Ll_transcript_525587 |
---|---|
CDS coordinates | 55-834 (+) |
Peptide sequence | MSKLIFCVFLTFTLIPLLCTSFSSDTPSDRRVLVLLDDFALKTSHSLYFNSLHSRGFDLDFKLAHDPKIALQRYGQYLYDALILLCPTIERFGGSIDAAAILDFVDSGHDLIVAADSNASDLIREIATESGVDFDEDPASFVVDHSGYAVSASEGDHTLIASDDFIKSDVILGSKKIEAPVLFQGIGHSLNPSNSLVLKVLSASPSAYSANPKSKLTSPPSLTGSTISLVSVIQARNNARILISGSLSLFSNRYEMLMS* |
ORF Type | complete |
Blastp | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit from Oryza sativa with 74.56% of identity |
---|---|
Blastx | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit from Arabidopsis with 72.5% of identity |
Eggnog | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase(ENOG410XSF3) |
Kegg | Link to kegg annotations (4342702) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413864.1) |
Pfam | Oligosaccharyltransferase 48 kDa subunit beta (PF03345.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer