Protein coding transcript 41913

• Transcript: Ll_transcript_525581
• CDS coordinates: 55-834 (+)
• Peptide sequence: MSKLIFCVFLTFTLIPLLCTSFSSDTPSDRRVLVLLDDFALKTSHSLYFNSLHSRGFDLDFKLAHDPKIALQRYGQYLYDALILLCPTIERFGGSIDAAAILDFVDSGHDLIVAADSNASDLIREIATESGVDFDEDPASFVVDHSGYAVSASEGDHTLIASDDFIKSDVILGSKKIEAPVLFQGIGHSLNPSNSLVLKVLSASPSAYSANPKSKLTSPPSLTGSTISLVSVIQARNNARILISGSLSLFSNRYEMLMS*
• ORF Type: complete

Annotations of Ll_transcript_525581

• Blastp: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit from Oryza sativa with 74.56% of identity
• Blastx: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit from Arabidopsis with 72.5% of identity
• Eggnog: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase(ENOG410XSF3)
• Kegg: Link to kegg annotations (4342702)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413864.1)
• Pfam: Oligosaccharyltransferase 48 kDa subunit beta (PF03345.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;