Protein coding transcript 41956

• Transcript: Ll_transcript_525383
• CDS coordinates: 917-1795 (+)
• Peptide sequence: MIGSLIKYNYRWYQFSEFNCSSVDMLHNPSYYIFQLELLLHVCIFDVHTRFVRLLIIKINFFIQINPDSAKGYKSRGIARALLGQWEEAAKDLHVASKLDFDEEISAVLKKVEPNAHKIEEHRRKYERLHKEKEEKKAERERQRRRAEAQAAYEKAKKQEQSSSSRNPGGFPGGMPGGFPGGMPGGGFPGGMPGGGFPGGMPGGGFPGGMPGGGFPGGMPGAGGMPGGVPGNVDFSKILNDPDLMSAFSDPEVMAALQDVMKNPANLAKHQSNPKVAPVIAKMMSKFGGGPK*
• ORF Type: complete

Annotations of Ll_transcript_525383

• Blastp: FAM10 family protein At4g22670 from Arabidopsis with 77.36% of identity
• Blastx: FAM10 family protein At4g22670 from Arabidopsis with 66.67% of identity
• Eggnog: suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)(ENOG410XR19)
• Kegg: Link to kegg annotations (AT4G22670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446678.1)
• Pfam: Domain of unknwon function (DUF3824) (PF12868.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;