Protein coding transcript 42127

• Transcript: Ll_transcript_526490
• CDS coordinates: 2943-3590 (+)
• Peptide sequence: MSSVFRSVALTLIGGVQHVDASGTRVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDEFDSMREHDRATIHEAMEQQTISVAKAGLVTTLSTKTTVFGATNPKGHYDPDQPLSVNTSLSGPLISRFDIVLVLLDTKNPEWDAVVSSHILSEAEPDKAKNDEDLANIWPLSTLKR*
• ORF Type: complete

Annotations of Ll_transcript_526490

• Blastp: Probable DNA helicase MCM9 from Arabidopsis with 87.56% of identity
• Blastx: Probable DNA helicase MCM9 from Arabidopsis with 87.56% of identity
• Eggnog: dna replication licensing factor(COG1241)
• Kegg: Link to kegg annotations (AT2G14050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426007.1)
• Pfam: MCM2/3/5 family (PF00493.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;