Transcript | Ll_transcript_526480 |
---|---|
CDS coordinates | 2943-3590 (+) |
Peptide sequence | MSSVFRSVALTLIGGVQHVDASGTRVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDEFDSMREHDRATIHEAMEQQTISVAKAGLVTTLSTKTTVFGATNPKGHYDPDQPLSVNTSLSGPLISRFDIVLVLLDTKNPEWDAVVSSHILSEAEPDKAKNDEDLANIWPLSTLKR* |
ORF Type | complete |
Blastp | Probable DNA helicase MCM9 from Arabidopsis with 87.56% of identity |
---|---|
Blastx | Probable DNA helicase MCM9 from Arabidopsis with 87.56% of identity |
Eggnog | dna replication licensing factor(COG1241) |
Kegg | Link to kegg annotations (AT2G14050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426007.1) |
Pfam | MCM2/3/5 family (PF00493.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer