Protein coding transcript 42141

• Transcript: Ll_transcript_526484
• CDS coordinates: 59-535 (+)
• Peptide sequence: MIEKDECEKSMASYLIRHHSNQLRSIASSADPNLHFPLFLDFAEFMADEPHIASLLFFHPTTYFHLFDNAALWAHNIIFSELLATHNDNNVVEKKFIHVRVNIFGSPLECPETFPSIGRVRVQHHGILLTLKGTVIRSGATKMHEGERKYICQKCQNR*
• ORF Type: complete

Annotations of Ll_transcript_526484

• Blastp: Probable DNA helicase MCM9 from Arabidopsis with 53.02% of identity
• Blastx: Probable DNA helicase MCM9 from Arabidopsis with 53.02% of identity
• Eggnog: dna replication licensing factor(COG1241)
• Kegg: Link to kegg annotations (AT2G14050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426007.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;