Transcript | Ll_transcript_526484 |
---|---|
CDS coordinates | 59-535 (+) |
Peptide sequence | MIEKDECEKSMASYLIRHHSNQLRSIASSADPNLHFPLFLDFAEFMADEPHIASLLFFHPTTYFHLFDNAALWAHNIIFSELLATHNDNNVVEKKFIHVRVNIFGSPLECPETFPSIGRVRVQHHGILLTLKGTVIRSGATKMHEGERKYICQKCQNR* |
ORF Type | complete |
Blastp | Probable DNA helicase MCM9 from Arabidopsis with 53.02% of identity |
---|---|
Blastx | Probable DNA helicase MCM9 from Arabidopsis with 53.02% of identity |
Eggnog | dna replication licensing factor(COG1241) |
Kegg | Link to kegg annotations (AT2G14050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426007.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer