Protein coding transcript 42153

• Transcript: Ll_transcript_525608
• CDS coordinates: 222-1490 (+)
• Peptide sequence: MITLLDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFISTNNPYAMNFRFIAADTLQKIIMLFALAMWTNFTANGSLEWMITIFSLSTLPNTLVMGIPLLIAMYGDYSGNLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSDVVSLDGRDFLETDAEVGDDGKLHVTVRKSNASRRSFMMTPRPSNLTGAEIYSMSSSHNPTPRGSNFNHGDFYSMMGYQARHSNFGATDLYSVQSTSRGPTPRPSNFEENGAAMGQNMSSPRFGFYPAQTMPASYPVPNPEFSSSFSKSVKNSQPQTQPQPQVVQNSTKSSHDAKELHMFVWSSSASPVSEGTGLHVFSGADLGASDQGAKEIRMVVAEENPQTEANKGNNVHEFFKIKTNLV*
• ORF Type: complete

Annotations of Ll_transcript_525608

• Blastp: Auxin efflux carrier component 4 from Arabidopsis with 88.76% of identity
• Blastx: Auxin efflux carrier component 3 from Arabidopsis with 69.79% of identity
• Eggnog: auxin efflux carrier(ENOG410Y9XE)
• Kegg: Link to kegg annotations (AT2G01420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017436535.1)
• Pfam: Membrane transport protein (PF03547.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;