Transcript | Ll_transcript_525674 |
---|---|
CDS coordinates | 227-1456 (+) |
Peptide sequence | MLSDEYFSEEECKDLHQRVKDGLLKKPMIVDVEKMARALHEDMTKHWLARELTMIQNLIDLANEKGWRRELYEYLQKREKLQNPVEQERLLHEIPQAIAEDLESESPTSDVPEDGELESLTPYVSDKRVENNSRELRKSASKQASLVTEVPKAVEGGFLWKATKPDVPGDLELESQIPVVPDKGVKNNLQELWKTTSKKAHLVSEAPKAVADGFLLKATKLDIADLVKEETNSPKSTSGLYAASKVPLFNMEMNSTVLNVFSRGTAAVHQSSTMPLQQQPVQHIDLNEDVSNADESNETKICKASEDRPVNPSQPDVKQLSDDDEGKKSKTTIQVPAEVLESLIWYYRDPHGAVQGPFSLTSLKRWSDGNYFPPNFMVWKDGQSQFESELLVTILNQFFPVDQSANNQF* |
ORF Type | complete |
Blastp | Uncharacterized protein At5g08430 from Arabidopsis with 61.95% of identity |
---|---|
Blastx | Uncharacterized protein At5g08430 from Arabidopsis with 59.42% of identity |
Eggnog | SWI SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member(COG5531) |
Kegg | Link to kegg annotations (AT5G08430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436831.1) |
Pfam | GYF domain (PF02213.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer