Protein coding transcript 42177

• Transcript: Ll_transcript_525663
• CDS coordinates: 97-1203 (+)
• Peptide sequence: MQIVQWLARELTMIQNLIDLANEKGWRRELYEYLQKREKLQNPVEQERLLHEIPQAIAEDLESESPTSDVPEDGELESLTPYVSDKRVENNSRELRKSASKQASLVTEVPKAVEGGFLWKATKPDVPGDLELESQIPVVPDKGVKNNLQELWKTTSKKAHLVSEAPKAVADGFLLKATKLDIADLVKEETNSPKSTSGLYAASKVPLFNMEMNSTVLNVFSRGTAAVHQSSTMPLQQQPVQHIDLNEDVSNADESNETKICKASEDRPVNPSQPDVKQLSDDDEGKKSKTTIQVPAEVLESLIWYYRDPHGAVQGPFSLTSLKRWSDGNYFPPNFMVWKDGQSQFESELLVTILNQFFPVDQSANNQF*
• ORF Type: complete

Annotations of Ll_transcript_525663

• Blastp: Uncharacterized protein At5g08430 from Arabidopsis with 57.75% of identity
• Blastx: Uncharacterized protein At5g08430 from Arabidopsis with 57.75% of identity
• Eggnog: SWI SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member(COG5531)
• Kegg: Link to kegg annotations (AT5G08430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436831.1)
• Pfam: GYF domain (PF02213.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;