Transcript | Ll_transcript_525668 |
---|---|
CDS coordinates | 954-1433 (+) |
Peptide sequence | MEMNSTVLNVFSRGTAAVHQSSTMPLQQQPVQHIDLNEDVSNADESNETKICKASEDRPVNPSQPDVKQLSDDDEGKKSKTTIQVPAEVLESLIWYYRDPHGAVQGPFSLTSLKRWSDGNYFPPNFMVWKDGQSQFESELLVTILNQFFPVDQSANNQF* |
ORF Type | complete |
Blastp | Zinc finger CCCH domain-containing protein 44 from Arabidopsis with 47.46% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein 44 from Arabidopsis with 47.46% of identity |
Eggnog | GYF domain-containing protein(ENOG41120EC) |
Kegg | Link to kegg annotations (AT3G51120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436834.1) |
Pfam | GYF domain (PF02213.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer