Protein coding transcript 42261

• Transcript: Ll_transcript_525736
• CDS coordinates: 67-465 (+)
• Peptide sequence: MFFSFLHIFTWLLWCLQDVEIRERVDVIVSEWMGYMLLYESMLQSVIIARDRWLKRGGLMLPSDATLYMAPVTNIEVYREITHFWEDVYGIDMSPIIPLSKKCAFEEPSLETITYENVLTWPIEVSPLSVTV*
• ORF Type: complete

Annotations of Ll_transcript_525736

• Blastp: Probable protein arginine N-methyltransferase 6.2 from Oryza sativa with 69.16% of identity
• Blastx: Probable protein arginine N-methyltransferase 6.2 from Oryza sativa with 69.16% of identity
• Eggnog: Protein arginine n-methyltransferase(ENOG410XQYH)
• Kegg: Link to kegg annotations (4348964)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427339.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;