Transcript | Ll_transcript_525736 |
---|---|
CDS coordinates | 67-465 (+) |
Peptide sequence | MFFSFLHIFTWLLWCLQDVEIRERVDVIVSEWMGYMLLYESMLQSVIIARDRWLKRGGLMLPSDATLYMAPVTNIEVYREITHFWEDVYGIDMSPIIPLSKKCAFEEPSLETITYENVLTWPIEVSPLSVTV* |
ORF Type | complete |
Blastp | Probable protein arginine N-methyltransferase 6.2 from Oryza sativa with 69.16% of identity |
---|---|
Blastx | Probable protein arginine N-methyltransferase 6.2 from Oryza sativa with 69.16% of identity |
Eggnog | Protein arginine n-methyltransferase(ENOG410XQYH) |
Kegg | Link to kegg annotations (4348964) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427339.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer