Transcript | Ll_transcript_526877 |
---|---|
CDS coordinates | 77-787 (+) |
Peptide sequence | MAGASFYTSCLFSPSNLGTSSSVLKTHNARAAAPWKLPQRRRFRIKAEVEYVNAEQAKDLVAVEGYTVLDVRDRIQFERAHIKSSYHVPLFIENKDNDPGTILKRTLHNNFSGLFYGLPFTKPNPDFVQSVKSQFQPESKILVVCQEGLRSAAAASKLEQAGFSDVKSITSGLQKVKSGTFESVGSTELQNAGKAGLVTIQGKISAVLGTVLICAYLFITFFPDQAEKLFQLVPTS* |
ORF Type | complete |
Blastp | Rhodanese-like domain-containing protein 9, chloroplastic from Arabidopsis with 73.23% of identity |
---|---|
Blastx | Rhodanese-like domain-containing protein 9, chloroplastic from Arabidopsis with 73.23% of identity |
Eggnog | Rhodanese-like domain(ENOG4111KQZ) |
Kegg | Link to kegg annotations (AT2G42220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417987.1) |
Pfam | Rhodanese-like domain (PF00581.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer